Tags
Tab Item Content
Join Us!
Archives Meta
Notifications
Clear all

Heroes [Solved] Filipino inventions & influence around the world.

124 Posts
11 Users
16 Reactions
137.3 K Views
josh avatar
Posts: 4380
Registered
Topic starter
(@zexsypmp23)
Member
Joined: 8 years ago

Philippine-made Concept Supercars

 
This is what a couple of Philippine-made concept supercars look like
                           Patrick Everett Tadeo

                           TopGear,  23 May 2014
 
If you're dropping by the 2014 Trans Sport Show this weekend, among the displays you absolutely have to check out are the two cars entered by Factor Aurelio Automobile. Factor Aurelio Automobile is a fledgling car manufacturer based in San Pedro, Laguna. The company takes its name after the surnames of Kevin Factor, an engineering student at Adamson University and the designer of the still-unnamed car, and Brendan Aurelio, the owner of Pacita Fibertech and the vehicles' architect and builder.
 
 
 
 First prototype and is powered by Honda B16A engine
The two cars on display look similar but are slightly different from one another. The yellow one is actually the very first prototype and is powered by a Honda B16A engine. The orange one is supposedly closer to production and has a Mitsubishi 4G63T turbocharged engine. Both vehicles are made of fiberglass and carbon fiber, and utilize VR4 front and rear suspensions and 18-inch Rota wheels.
 
We asked Factor how close the orange car is to completion, and it's reportedly 80% finished. "We just need to finish the interior and complete some of the exterior items," he pointed out. As to why Factor Aurelio Automobile chose to run an in-line-four engine, it was a matter of cost. "It's easier to fix since there's an abundance of spare parts, but depending on the customer, we can put their choice of engine inside," Factor shared.
 
A close to production prototype
with Mitsubishi 4G63T turbocharged engine
The company hopes to have a production-model unit ready before the end of the year, with a price tag in the range of P1.5 to P1.6 million. "We only plan to make 10 units; that way, the cars can retain their value," added Factor. "If we make more than that, the cars will lose their value because they won’t be unique anymore." 
 
So, would you buy a locally manufactured, P1.6-million "supercar" if it went on sale today?

Source:
TopGear


Reply
josh avatar
Posts: 4380
Registered
Topic starter
(@zexsypmp23)
Member
Joined: 8 years ago

Air Cleaning Device with Ionizer (Nature's Air Room Ionizer)

 
A breath of fresh air


Nature's Air air cleaning device with ionizer

Air pollution may well be dubbed as the silent killer for it harms the unsuspecting individual who inhales its harmful micro-components. Through the years, the quality of air in many parts of the world has been deteriorated continuously and beyond acceptable standards. There are several types of air pollutants but the most common are particulate matters, nitrogen dioxide, carbon monoxide, and total oxidants. Other equally harmful air pollutants are hydrocarbons and nitrogen oxides. Medical experts discovered 18 species of pathogenic fungi and 20 types of bacteria in the circulating dust.

Metro Manila's surrounding air has no cleaner. A study done by the Department of Environmental and Natural Resources (DENR) and the Asian Development Bank (ADB) found that pollution level in the metropolis is three times the normal level with particulate matter of nearly 600 exceeding the WHO safe dust level of 120 micrograms per cubic meter of air.
 
Now, we are introducing our latest technology, an air cleaning device with ionizer that will eventually removes smoke, dust particle, odors and even air-borne micro-organisms that spread diseases inside your room and your office. 
 
Benefits of Nature's Air
  • It will remove airborne contaminants.
  • Activated carbon filter will remove odors/fumes emitted from closets, household cleaners, paints varnishes, personal care products, cigarettes and cooking smoke.
  • Negative ions revitalized the air just like the natures after the storm, near a waterfall or near the seashore. Studies show that the negative ions beneficially affect human biochemistry both physically and mentally.

Description

 
Nature's Air, an environmental friendly invention, is a perfect solution for this kind of environment that we suffer from odors and microorganisms. This latest Filipino technology helps eliminate harmful dust particles, smoke and airborne microorganism that spread diseases in children and elderly.
 
The properly-designed modern ion emitter produces a combination of negative and positive ions in a ratio of 4:3. This ratio helps the dust particles and carbon monoxide settle to the dust collector inside the unit, rather than on other surfaces. The excess of negative ions also helps to restore nature’s ion balance and enhance natural health and well being of the user.
 
Technical specifications

A new and improved air ionizer, the NATURES AIRE is available for purchase. Go to our online store for contact details.

 
Source:
Rodolfo Biescas Sr.

Reply
josh avatar
Posts: 4380
Registered
Topic starter
(@zexsypmp23)
Member
Joined: 8 years ago

Lunasin’s biological activity and medical importance, discovered by a Filipino

 
A space-filing model of the Lunasin's structure
Lunasin is a 43-amino acid polypeptide discovered by a team of Japanese scientists in 1987. It was originally isolated, purified, and sequenced from soybean seed. Although no name has been given, it was described as an amino acid sequence of a soybean (Glycine max) seed polypeptide having a poly (L-aspartic acid) structure at the carboxyl terminus by its discoverers. Subsequent research by Dr. Alfredo F. Galvez at the University of California- Berkeley, identified the peptide as a subunit of the cotyledon-specific 2S albumin. Its amino acid sequence is SKWQHQQDSCRKQKQGVNLTPCEKHIMEKIQGRGDDDDDDDDD. Due to the health benefits of soy in which it was extracted, Dr. Galvez and associates named it as Lunasin from the Filipino word “lunas” which means ”cure”. Aside from soy as its main source, it is also found in barley, wheat, amaranth, black nightshade, pinto bean, corn and rye.

Discovery of biological activity
 
Lunasin’s biological and cancer-preventive activity was discovered by a Filipino doctor during his post-doctoral research --- Dr. Alfredo Galvez in Dr. Benito de Lumen’s (another Filipino doctor) laboratory in the University of California – Berkeley in 1997. This is an excerpt from Dr. de Lumen’s statement on the discovery of Lunasin, “Many years ago, my laboratory initiated a project on enhancing the nutritional of soy protein and other legumes through bioengineering. This requires increasing the level of methionine, the essential amino acid, which is most limiting in soy and other legumes, including mung bean. The strategy is quite straightforward: clone a gene coding for methionine-rich protein (MRP) and over-express the gene in soy or any target legume. We were faced with two choices for the source of the MRP gene – obtain it from other plants or from soy itself. I made the fateful decision to clone the MRP gene from soy itself, which eventually led to the discovery of lunasin as a cancer preventive agent.”
 
Dr. Alfredo F. Galvez: discoverer of
Lunasin's mitotic activity
“The choice to clone the MRP gene from soy is based on the hypothesis that there must be non-abundant MRPs in soy because most of the proteins in soy seed are notoriously low in methionine and therefore, there must be other MRPs that contribute to the overall methionine content of soy protein but they are non-abundant. The process of cloning the MRP gene turned out to be not easy, taking about four years, two graduate students and a postdoctoral scientist. One of the graduate students is a Filipina (now Dr. Jamie Revilleza from UPLB), and the postdoctoral scientist is another Filipino from UPLB (Dr. Alfredo Galvez). Dr. Revilleza contributed to the purification of the MRP from soy that eventually led to the cloning of the gene, and Dr. Galvez took over the project and discovered the anti-mitotic effect of the lunasin gene when transfected into mammalian cells and the cancer preventive effect of the lunasin peptide. While it was not by design that the major contributors to lunasin discovery were both Filipinos, it is a source of pride to point this out.”

Cancer research
 
Lunasin has a unique epigenetic mechanism that interferes at the very early stages of the carcinogenic process; Lunasin is non tissue-specific and would be effective against different types of cancer. In addition, Lunasin has no known toxic effects, which is consistent with its presence in soybean that has been consumed in Asia for centuries.
 
Dr. Galvez was the first to identify the peptide’s ability to prevent the transformation of normal cells into cancerous tumors in cell culture. Animal studies validated the findings when lunasin significantly reduced the tumor incidence in mice skin exposed to chemical carcinogens. In the original 2001 study that discovered and named lunasin, the authors wrote that their results "suggest a mechanism whereby lunasin selectively induces apoptosis, mostly in cells undergoing transformation, by preventing histone acetylation"—the protein could cause cell death in developing cancer cells, while not affecting regular cells, in mice. This led to the speculation that lunasin might explain the numerous epidemiological associations between consumption of soy products and the low cancer incidence observed in Asian populations. In 2003 a study conducted by Bio-Rad Laboratories showed that the protein also did not affect immortalized and established cancer cells.
 
In 2008 a study performed by Dr. de Lumen found that lunasin was found to help prevent chemical carcinogens and oncogenes from causing cancer in a skin cancer mouse model. The peptide becomes bioavailable in mice through ingestion within a few minutes and reaches the nucleus of cells within eighteen hours. The effectiveness was shown only against non-established cancer cell lines in this study. In 2009 another study was performed at the Andong National University, that found further evidence of the inhibition of histone acetyl transferase. In addition, lunasin has also been shown to bind deacetylated histones, which can also help to prevent cancer. Wayne R. Bidlack and Raymond L. Rodriguez wrote that the inability for lunasin to kill established cancer cells was due to a genetic change in cells when they are first becoming cancerous, which disappears when a cell becomes fully cancerous. They also write that the food has the potential to reduce cancer risk, though not affect existing cancer cells in a patient, and could provide help in explaining an inverse correlation between soy consumption and the risk of some cancers.
 
Extensive researches on Lunasin's cancer-preventive ability shows that Lunasin internalizes inside the cell and ends up mostly in the nucleus; inhibiting core histone acetylation and activating tumor suppressor genes such as PTEN.

 
Lunasin selectively inhibits transcription, a dynamic process that occurs at various locations and at different times in the cell and is initiated by unfolding of the chromosomes; a process facilitated by histone acetylation.
 
It is proposed that during the initiation of the carcinogenic process that involves transcription, the dynamic process of histone acetylation-deacetylation is disrupted. This evidence demonstrates that the molecular mechanism for Lunasin is profound, compared to other cancer preventative agents in that it selectively kills cells that are transforming into cancer cells, without affecting normal cells. 
A graphical representation on Lunasin's mechanism of action as a cancer-preventive peptide
 
Since Lunasin has a unique epigenetic mechanism that interferes at the very early stages of the carcinogenic process, this suggests that Lunasin is non tissue-specific and would be effective against different types of cancer. In addition, Lunasin has no known toxic effects, which is consistent with its presence in soybean that has been consumed in Asia for centuries.
 
The novel mechanism of action by Lunasin makes it an important research tool in understanding epigenetic control of gene expression during cancer development. Together with powerful tools in genomics and proteomics, Lunasin can be used to identify potential drug targets and diagnostic biomarkers.

Cardiovascular and cholesterol management research
 
Lunasin's ability to support cardiovascular health was acknowledged by the American Heart Association at their Annual Scientific Session in November, 2012, and Dr. Alfredo Galvez's presentation abstract was selected for publication in the AHA Journal, Circulation. 
 
Lunasin works in two ways to lower serum LDL cholesterol levels. First, it selectively disrupts a necessary step in the production of a key enzyme, HMG-CoA reductase. Lunasin reduces the acetylation of the Histone H3 tail by PCAF (lunasin blocks PCAF's specific binding position at K14), thus reducing the level of expression of the HMG-CoA reductase gene. With levels of the HMG-CoA reductase enzyme lowered and available for the liver to carry out cholesterol synthesis, the liver in turn produces less cholesterol.
 
Secondly, Lunasin upregulates the expression of the LDL-receptor gene. With an increase in the number of receptors available to clear LDL cholesterol from the bloodstream, LDL levels also decrease. Studies show that in the presence of Lunasin, the levels of SP1 (the coactivator of SREBP for LDL-receptor production) are two times higher than without Lunasin present. With SP1 more readily available to bind with SREBP, the LDL receptors are produced more efficiently, so more LDL cholesterol is pulled from the bloodstream, thereby reducing the circulating serum LDL levels.
 
Lunasin's cholesterol-lowering mechanism of action
Since 70-80% of the circulating cholesterol in your body is produced within your liver, it is important to target this process in addition to consuming less saturated fat and cholesterol in your diet. Lunasin works at an earlier stage in your body’s internal cholesterol production process than prescription statins. Lunasin reduces the amount of HMG-CoA reductase enzyme produced by the HMG-CoA reductase gene. Statin drugs work by blocking the HMG-CoA reductase enzyme after it has been produced when it is on its way to carry out the body’s internal cholesterol production cycle. Statin drugs can oftentimes be too efficient and block too much of the HMG-CoA enzyme. This leads to serious side effects because a minimum level of cholesterol is required in the body for certain necessary cellular functions such as maintaining cell membrane integrity and hormone production.
 
Anti-inflammatory research
 
Other studies have shown that lunasin has the ability to inhibit the aberrant inflammation that can occur in chronic diseases, including cancer. This property was also discovered by a team including Benito O. de Lumen, along with Elvira Gonzalez de Mejia, Vermont P. Dia, as well as others, as a part of research attempts to create purified lunasin through a more inexpensive means.

Benefits of Lunasin
 
The following list includes some of the many benefits of Lunasin while on going in-depth research continues to uncover more.
  • Bio-active peptide with an epigenetic mode of action
  • Natural component of soy and other seeds – favorable public perception
  • GRAS (Generally Recognized as Safe) by the FDA
  • Ideal chemo-preventative agent to fight skin cancer
  • Extends cell longevity (anti-aging) *Unpublished
  • Anti-oxidant effect: especially protects DNA from oxidation as well lipids
  • Anti-inflammatory effect
  • Effective dose is minimal
  • Non-invasive treatment

Lunasin’s patents

 
After its discovery, several researches have been made and patents applied. Patents applied by Dr. Alfredo Galvez and/or Dr. Benito de Lumen are as follows: CA2303061A1, CA2303061C, DE69830066D1, EP1017798A1, EP1017798B1, US6107287, US6544956, US7375092, US20030229038, and WO1999015642A1.
 
Commercial Lunasin products
 
Due to the proven studies in various health benefits of Lunasin, several companies commercialize the peptide as food supplements. Dr. Galvez licensed Lunasin worldwide rights to Reliv International, a food science and manufacturing company. Reliv possesses the only proprietary mechanical extracting process that does not use chemicals. They also hold the patent to the peptide, the ability to make it bioactive and any and all future applications of the supplement.
 
A bottle of LunaRich XTM
Reliv International released its LunaRich® Soy Powder in February 2012 and claim to contain five to ten times more lunasin than ordinary soy powders, and it delivers that elevated lunasin in a more bioavailable way. In addition, LunaRich® soy powder contains other beneficial nutritive components of soy, including protein, isoflavones and more. Another Reliv’s product that was launched in January 2013 is the LunaRich XTM  According to Galvez, LunaRich XTM is a form of Lunasin that is bioactive. It’s a shepherd molecule travels with the lunasin in the body as it remains active after digestion. LunaRich X, the capsule form, is said to have lunasin potency 200 times more than high quality soy protein. One 125mg capsule of LunaRich XTM delivers the same amount of bioactive lunasin found in 25 grams of high-quality soy protein, the daily amount identified by the Food and Drug Administration to help reduce the risk of heart disease. A two-month supply retails at less than $100. Wholesale for the same quantity is less by $20.
 
Another companies are SoyLabs and FilGen, Inc. 
 

Reply
josh avatar
Posts: 4380
Registered
Topic starter
(@zexsypmp23)
Member
Joined: 8 years ago

Jollibee - one of the largest Filipino-owned fastfood chain in the world

 
Jollibee logo
Jollibee Foods Corporation (PSE: JFC) (widely known as Jollibee) is a fast-food restaurant chain based in the Philippines. As of December 2007, Jollibee has become one of the biggest fast-food chains in the world with 1,655 stores worldwide (although its own web site claims only 600) and total sales of more than US$1 billion. As of March, 2008, JFC has 1,466 stores in the Philippines namely, Jollibee (627), Chowking (377), Greenwich Pizza (236), Red Ribbon Bakeshop (194), Délifrance (28) and Manong Pepe's (4). According to its own web site, it has 23 stores overseas. As of end-September, 2008, JFC has 1,490 local and 228 foreign stores in its portfolio.

Foundation and History
 
Tony Tan Caktiong and his family opened a Magnolia Ice Cream parlor in Cubao in 1975. The original name was Jolibe. Sometime in 1978, Tony Tan and his brothers and sisters, being partners, engaged the services of a management consultant in the person of Manuel C. Lumba. Lumba became Tony Tan's first business and management mentor.
 
Consultant Lumba shifted the business focus from ice cream to hamburgers, after his studies showed that a much larger market was waiting to be tapped. He had the name changed from Jolibe to Jolly Bee, then to the one-word name Jollibee. Next, Lumba conceptualized the Jollibee mascot, inspired by local and foreign children's books, and created the product name "Yumburger" as well as "Chickenjoy". He had the company incorporated and leased a house on Main St. in Cubao, Quezon City, as their first headquarters.
 
Lumba also formulated the company's long-term marketing strategy, listing a number of consumer promotions and traffic-building schemes. Tony Tan stressed that developing internal strengths was primary. The stores were re-designed, the restaurant transformed into a full self-service, fast food operation with drive thrus. Not long after, Tony Tan and Manny Lumba went on an observation tour in the United States, attended food service and equipment conventions. Tony Tan put Manny Lumba in charge of franchise development.
 
Expansion and Acquisitions
 
The company acquired 80% of Greenwich Pizza Corp. in 1994, enabling it to penetrate the pizza-pasta market. From being a 50-branch operation, Greenwich has established a strong presence in the food service industry. In early 2006, Jollibee Foods Corp. bought out the remaining shares of its partners in Greenwich Pizza Corp., equivalent to a 20% stake, for P384 million in cash.
 
In 2000, the company acquired Chowking, allowing Jollibee to be part of the oriental quick service restaurant market. In 2005, they acquired Red Ribbon Bakeshop, another popular restaurant chain in the Philippines. 
 
In 2004, Jollibee acquired Chinese fast food chain Yonghe Dawang for $22.5 million. Jollibee entered into a joint-venture contract with US-based Chow Fun Holdings LLC, the developer and owner of Jinja Bar Bistro in New Mexico, in which Jollibee will have a 12% stake for $950,000. Jollibee purchased 70% of Taipei restaurant Lao Dong in June and Chun Shui Tang tea house in 2006. In the same year, the company acquired the franchise of Délifrance. This further expanded its penetration in the food service industry, particularly in the French cafe-bakery, a growing segment of the Philippine food market. In September of 2006, the company acquired the remaining 50% stake of Delifrance Asia Ltd. in Baker Fresh Foods Phils., Inc. (BFFPI). This means BFFPI is now a wholly owned subsidiary of Jollibee and that the listed food giant has the exclusive rights to operate Delifrance outlets in the country. "The acquisition involved a restructuring of all advances by Jollibee and Delifrance Asia amounting to P130 million into equity," a public statement said. Jollibee added that the strong sales posted by Delifrance encouraged it to buy out its partner.
 
Jollibee's locations worldwide as of 2013
The corporate actions in buying out the minority shareholders in Greenwich Pizza (20%) and Delifrance (50%) were the prelude to a plan to integrate the Greenwich Pizza, Chowking, and Delifrance brands under one corporate entity. Under this plan, merging of the subsidiaries would be implemented by having Greenwich Pizza Corp. and BFFPI folded into Chowking Food Corp. The surviving entity would be renamed Fresh 'N Famous Foods, Inc. No new shares would be issued as the assets of Greenwich and BFFPI will be injected into Fresh 'N Famous as additional paid-in capital.
 
On July 25, 2007, Jollibee launched its pilot restaurant "Tio Pepe's Karinderia" in Edsa Central in Mandaluyong, to professionalize the Philippine carinderia business.
 
On August 26, 2008, Jollibee formally signed a P2.5 billion ($55.5 million) deal with Beijing-based Hong Zhuang Yuan through its wholly owned subsidiary Jollibee Worldwide Pte. Ltd. The sale is subject to the approval of China's Ministry of Commerce.
 
On October 19, 2010, Jollibee acquired 70% share of Mang Inasal, a Filipino food chain specializing in barbecued chicken, for P3 billion ($68.8 million). The same month, Jollibee signed a deal to acquire 55 percent of China's Guangxi San Ping Wang Food and Beverage Management Co. Ltd., operators of the San Pin Wang beef noodle business for 30 million RMB.
 
On October 1, 2011, Jollibee acquired a 54% stake in BK Titans, Inc., the sole franchisee of Burger King in the Philippines. In the same year, Jollibee opened 260 new stores, of which 167 were in the Philippines led by Mang Inasal (86) and Jollibee (40). This brought the company's total number of stores to 2,001 as of end December 2011. The same year, Jollibee closed Manong Pepe foodchain in favor of Mang Inasal, and sold Délifrance to CaféFrance. In the same year, the company acquired Chowking stores in the US from their licensee, Burger King business in the Philippines and SuperFoods business in Vietnam and other Southeast Asian countries.
 
 
Overseas, Jollibee opened 93 stores, led by Yonghe King in China (70) and Jollibee Vietnam (11). Currently, it also has locations in the United States, Saudi Arabia, Hong Kong, Vietnam, Malaysia, Indonesia, Dubai and Brunei. Jollibee is also the name of their mascot, a large bee in a blazer, shirt and chef's hat.
 
Products and Services
 
The famous Jollibee Chickenjoy meal
Jollibee is an American-style fast-food restaurant with Filipino-influenced dishes specializing in burgers, spaghetti, chicken and some local Filipino dishes. In the Philippines, Jollibee serves Coca-Cola products for its beverages; in overseas markets, the chain serves Pepsi products. 
 
Jollibee has a variety of menu choices. Some of its menu items are as follows: 
  • Chickenjoy - fried chicken
  • Champ - a half-pound burger with tomato, lettuce, cheese, pickles, etc. (similar to McDonalds' Big Mac)
  • Jolly Spaghetti - spaghetti with the typical Filipino-style sauce (sweet and a bit spicy), hotdog slices and spiced ham
  • French Fries
  • Yumburger - regular hamburger with special dressing
  • Yumburger with Cheese
  • TLC Burger - hamburger with tomato, lettuce and cheese
  • Mushroom and Cheese Burger - hamburger with sauteed mushrooms and a cheese sauce
  • Aloha Burger - hamburger with bacon and pineapple ring
  • Burger Steak - served with mushroom sauce
  • Jolly Hotdog - hotdog sandwich topped with manhattan sauce (similar to 7-11's hotdog sandwich) and grated cheese
To provide their costumer better satisfaction, they offered the following services:
  • 8-7000 Jollibee Express Delivery Service
  • Jollibee Kids Party
  • Jollibee Drive Thru
  • 24-hour Service
  • 8 success secrets from Jollibee, which aims to be in world’s top 3

Secrets behind success
 
In the interview of the Philippine STAR in March 2013 in connection with Jollibee’s 35th Anniversary this year, Chief Operating Officer (COO) Ernesto “Ato” Tanmantiong revealed how the company made it to success.
  1. Customer focus — “The market is so dynamic and fast-changing, so we do a lot of research. When Jollibee was small and we had little research funds, we directly asked customers their needs and wants.” 
  2. Vision — Tanmantiong said, “When we started in 1978, people asked why we didn’t get a US franchise. We already wanted to create our own brand because we didn’t want to be limited to the Philippine market. Since the start, our vision was, first, to become No. 1 in the Philippines; second, to eventually expand overseas. Now our vision is we want to be one of the top three largest and among the most profitable restaurant companies in the world. Again, this is a big dream.” 
  3. Spirit of family and fun — “Among the Jollibee core values are unity and team work. We have less than 10 family members working at Jollibee group. We now have over 40,000 employees, roughly 4,000 of whom are managers. If you include the other brands, we have maybe more than 60,000 employees.” 
  4. Good quality — Tanmantiong said that the consistently “superior taste” of Jollibee foods is one success secret of their business. The family’s eldest sister Virgie Tan Chua was the one who started Jollibee spaghetti. When I asked if they had paid her for this recipe, Ato Tanmantiong laughed, saying, “Don’t give her the idea!”
  5. Location — Jollibee makes sure that its stores and affiliates are conveniently located.
  6. Good partners — Jollibee group has grown phenomenally due to good business partners through its franchising system. Today, 50 percent of Jollibee stores are owned by franchisees. Each franchise now costs about P25 million.
  7. Culture — “We make sure the whole organization shares our vision and values, meaning they’re all part of that,” Tanmantiong said. “Our corporate values are excellence, spirit of family and fun, humility to learn and listen, integrity, frugality, respect for the individual, and teamwork. Anybody who is not a fit to all that, we remove from the organization. Our people are more engaged and committed.”
  8. Marketing — The overall marketing programs and efforts have contributed to the success of Jollibee, from the brand name, logo, the popular mascot, TV commercials and print ads, to their very own TV show. Their top celebrity endorsers include Aga Muhlach, Sarah Geronimo, Gerald Anderson, Enchong Dee, Kim Chiu, international brand ambassador Jessica Sanchez and the very first endorser of the early 1980s, singer Gary Valenciano.

Reply
josh avatar
Posts: 4380
Registered
Topic starter
(@zexsypmp23)
Member
Joined: 8 years ago

Defiant 300 aircraft: ingenious Filipino invention

 
Another invention of Filipinos that became “trash” due to the lack of support from the government is the Defiant 300 aircraft. It proves Filipinos ingenuity in developing military hardware that poses capability in defending the country from threat if further improved. The Defiant 300 is a prototype turboprop aircraft designed for light attack, counter insurgency (COIN), close air support, aerial reconnaissance missions in low threat environments, as well as providing pilot training. It was made through the cooperation of Philippine Aerospace Development Corporation (PADC), Philippine Air Force (PAF) and the Philippine Aerospace and Sciences Foundation (PASF) in 1986. It was designed to operate in high temperature and humidity conditions in extremely rugged terrain and very suitable in the type of conditions that the Philippines’ have.
 
The Defiant 300 aircraft
Only one prototype was completely built and another one in an incomplete airframe. The aircraft made its first flight in 1987 which lasted in little more than an hour. The brain and the main designer of the plane was Capt. Panfillo Villaruel who also contributed to the design of the first indigenously built PADC Hummingbird helicopter.

The Defiant 300's fuselage was composite construction (wood and fiberglass) and was powered by a 300 hp Lycoming piston engine. Landing gear was taken from the Beech T-34 and provided by the PAF. The intent of the program was to provide the PAF with a trainer and light strike aircraft similar in performance to the Brazil’s Tucano. The Defiant 300 was to have been followed by a larger version equipped with a turboprop engine and designated the "Defiant 500". The overall cost of the project at that time (1987) was Php40 million.

The project languished soon after the development of the prototype because of lack of government support. Currently, the sole remaining prototype now lies abandoned and display at a hangar in Philippine State College of Aeronautics.

Source:
wikipedia.org
Photo credit
facebook.com

Reply
Page 20 / 23
Share: